SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000289153|PACid:22645153 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000289153|PACid:22645153
Domain Number 1 Region: 90-160
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000133
Family Calnexin/calreticulin 0.026
Further Details:      
 
Weak hits

Sequence:  MDP0000289153|PACid:22645153
Domain Number - Region: 178-248
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00051
Family B3 DNA binding domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000289153|PACid:22645153
Sequence length 292
Sequence
MEKDGGDRDNAALVTLIVMLLIMAMGVSSASSASAAAASSQLRRNLLANGLGLTPPMGRS
LILTKQTLLVWDRDGVGSVQKIHTSSEYEVDSIFYEPFSESFEGRWIVSSKDXYQGVWKL
SKSEGHDDYGLLVSEKARKYAVVKEMDKAVSLADGTVVLQSGSGYLKNNVPVKWVLLLYL
RSEFTQRHLHMKSAGGNAILKGPNGGTWSVKLKCENSKARTLNFLVCVFTLMKDVKLSFE
VFVFRTTEAANCRMSPTGPSDTSFSAFEAANKFVSSNPFFRVTHGLGSSRVL
Download sequence
Identical sequences MDP0000289153|PACid:22645153 MDP0000289153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]