SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000291591|PACid:22681743 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000291591|PACid:22681743
Domain Number 1 Region: 10-109
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.34e-24
Family B3 DNA binding domain 0.00044
Further Details:      
 
Domain Number 2 Region: 194-279
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000255
Family B3 DNA binding domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000291591|PACid:22681743
Sequence length 301
Sequence
MARNSTNPSWRVRSFFKPLVHDDFSRHLCLPPLFMENFNGRPPCKCTLRGPSGESWTVGL
EGREDGKFFFRKGWQNFVEDHLLEIGNFLVFKYDGDTKFDVKIYNPTGCEKEEAVAAKNT
TGNLASIRNRKKSMLYKPADVKETSDGHIAFRSKYKTCFKATVPKIPYRMILGKARHLSA
IPNRLVTDDVPSILQTVPKKLAVAKGLIEKERVRLTDPNGKTWKVKLRVEEIKSCGSRLL
MTEGLLKCWHANNISPGDTAVFELVNEKRSEMKIHFFRAEAGGKRPTVVLELDASDSVVE
N
Download sequence
Identical sequences MDP0000291591 MDP0000291591|PACid:22681743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]