SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000293482|PACid:22637734 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000293482|PACid:22637734
Domain Number 1 Region: 7-180,295-384
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.54e-42
Family FAD-linked reductases, N-terminal domain 0.016
Further Details:      
 
Domain Number 2 Region: 184-299
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.55e-25
Family PHBH-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000293482|PACid:22637734
Sequence length 420
Sequence
MSLKKKPKAVIVGGSIAGVSCAHTLISAGWDVLLVEKSYAPPTGSPTGAGLGLDPLSLRL
IQSWIQDPDLLHKATLPLTIDQNDAIDGENKVKWTLTRDEDFNCRAAHWADLHALLYNAL
PPNLFLWGHHFLSFSISSDKSSVIVKASSHQTNEIIEIVGDLLVAADGCLSSIRQSFVPD
HKLRYSGYCAWRGXLDFTGNESSETLTGIRKEYPELGKCLYFGLGSGTHTVLYELLNRRL
NWIWYVHQPEPDLKHNSMTMKASSDMIQSMHKEAEKMWLPEFVRVIKETKEPFINAIYDS
DPLEQIXWDKVVLVGDAAHPTTPHALRSTNMSVLDAAXLGQCLKKWGAEDLQSALEEYQS
IRLPVVSKQVLHARRMGRIKQGLVLPDRQLFNPETANPEECQXLQQKFMPFFWDVPSILL
Download sequence
Identical sequences MDP0000293482|PACid:22637734 MDP0000293482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]