SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000293613|PACid:22654008 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000293613|PACid:22654008
Domain Number 1 Region: 67-186,221-338
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.59e-36
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.079
Further Details:      
 
Domain Number 2 Region: 315-407
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.000000961
Family D-aminoacid oxidase-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000293613|PACid:22654008
Sequence length 629
Sequence
MATATRLRRLGAAACVATAASGAFLLQPSFSANDRGNGPSSLGAVRQRISDPNAVVPSRA
AQEAALISASASNPLDILVIGGGATGSGVALDAVTRGLRVGLVEREDFSSGTSSRSTKLI
HGGVRYLEKAVFNLDYGQLKLVFHALEERKQVIENAPHLCHALPCMTPCFDWFEVVYYWM
GLKMYDLVAGLRLLHVSRYYSAQESVELFPTLARKGNNKSLKGTVVYYDGQMNDARLNVG
LACTAAVAGAAVLNHAEVVALLKDEASNRTIGARIRDNLSGKEFDIYAKVVVNAAGPFCD
SLRKMADQDAKPMICPSSGVHIVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTIAGTT
DSNTSITLLPEPHEDEIQFILDAICDYLNVKVRRTDVLSAWSGIRPLATDPSAKSTESIS
RDHVVCEDYPGLVTITGGKWTTYRGMAEDAVNAAIKSGNLTPENGCLTSKLQIVGGDGWD
PASFTVIAQQYVRMKNSHGKVVPAVMDTAAARHLSHAYGTFAERVAAIAQNENLGKRLAH
GYPFLEAEVAYCARNEYCESAIDFIARRSRLAFLDTDAASKALPRVIEILATEHKWDNSR
QKYELEKAKEFLETFKSSKNAQFHDGKHV
Download sequence
Identical sequences MDP0000293613 MDP0000293613|PACid:22654008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]