SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000294016|PACid:22638766 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MDP0000294016|PACid:22638766
Domain Number - Region: 1-45
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0824
Family B3 DNA binding domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000294016|PACid:22638766
Sequence length 147
Sequence
MRDSTGREWRFTYVCWRNGMTVMYVLEGLNGYQWRAGDKVAFHRIVSEGKLQIRTIKAAS
SDPPALAKYWVIDWDLLFESSEFDPAKKGLRFGLAGGSVGQRRHVLAEVGDLDEDQDGEN
GCYAMRGKTWNKVLQRENLVLGSDKMV
Download sequence
Identical sequences MDP0000294016 MDP0000294016|PACid:22638766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]