SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000294615|PACid:22655955 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000294615|PACid:22655955
Domain Number 1 Region: 442-795
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.34e-58
Family GDI-like N domain 0.0000000225
Further Details:      
 
Domain Number 2 Region: 830-873
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000035
Family GDI-like N domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000294615|PACid:22655955
Sequence length 884
Sequence
MEAAEATIKQQVEYNIRLRAQLEYKILELHRYKLHESMAAQLLPSARESQDQAHQVAAAG
VDNRIEMIANHATKSMKVVRVFGTPTAADNASNGISRLSSPSTMTSLSPGRSTMEGDYGN
GLMPLTESNNPNSRMLKKDLVVRVHKHDQEIMQLRKHLADYSIKEAQTRNEKYVLEKRIA
GCVGGLRVQLLNLGFSLLKMLIKLLALCMNGHLPRAPMLLIIHFGTVFGKPTPRVELNFV
FGGFLEILPTRTNWRKKRVALENICVLCNSSRELALHVFSACPFARAVFFSSNIETGTRG
VVPSSFCNWLNQCPAALSSSQFGLLLMRCLFTLYGELILSYGTARWRTLHSCVILQAFIS
LILLKLSQPSNLATSVSFSLTSSPTVMDQDYVDVLSMLLQILGVLPHLIFLAYLLPINQI
PISLTQTQKNAEWVSLSSLKAMDEEYDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYY
GGESTSLNLNQLWKRFRGEDKPPETLGSSKDYNVDMIPKFMMANGGLVRVLIHTNVTKYL
NFKAVDGSFVYNKGKVHKVPANDVEALKSPLMGLFEKRRARKFFIYVQDYDENDPKSHEG
MDLNKVTARELILKYGLDDNTVDFIGHALALHRDDNYLAEPAMAFVKRMKLYAESLARFQ
GGSPYIYPLYGLGELPQAFARLSAVYGGTYMLSKPECKVEFENKKAIGVTSEGETAKCKK
VVCDPSYLPDKVKKVGKVARAICIMSHPIPNTQDSHSVQVILPQKQLGRKSDMYLFCCSY
SHNVAPKGKYIAFVLTEAETDNPQVELKPGTDLLGAVDEIFFDTYDRYEPTNQDAGDNCF
ISASYDATTHFETTVQDVIAMYSKITGKALDLSVDLSAASAAEE
Download sequence
Identical sequences MDP0000294615|PACid:22655955 MDP0000294615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]