SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000295277|PACid:22625688 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000295277|PACid:22625688
Domain Number 1 Region: 79-353
Classification Level Classification E-value
Superfamily PP2C-like 2.75e-68
Family PP2C-like 0.0000252
Further Details:      
 
Domain Number 2 Region: 445-764
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.56e-67
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000122
Further Details:      
 
Domain Number 3 Region: 785-907
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 6.19e-43
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0000005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000295277|PACid:22625688
Sequence length 908
Sequence
MVAEAEVICQETVLDMNYGVCVAKEHELQIDVASSSPTSPSFGEVVVAETIFPEISRFES
VLSCTEAINNAGMESSAVKFVPNIHSGSHSDIGPRDSMDDEHIRIDDLSAHVGALFKCPF
PSAFYAVFDGHGGPEAAAYIKRNAMRLFFEDANLLQRMDMDAVFFRELENSHRKAFLLAD
HALADEDSVRSSCGTTALTALILGRHLLVANAGDCRAVLCKKGVAVDLSQDHKPSYLPER
MRVEQLGGYFDDVYLNDSISVTRALGNWGLKLPFGSSSPLIAEPDVQQVMLTEDDEFLII
GCDGIWDVMSSQYAVSLVRRGLRRHDDPQLCAEELVKEALRLNTSDNLTVIVXIIVKKRL
IGQRSHLKAFYQAQQKRKAKRKRNEIVRGLTNRSFRRXMAMASLARRKAYLLSRNXSNTS
SEAVRYSFSLTSFSRGFASAGSDDNDVVVVGGGPGGYVAAIKAAQLGLKTTCIEKRGALG
GTCLNVGCIPSKALLHSSHMYYEAKHAFSHHGVKFSDVEIDLPAMMSQKDKAVSNLTRGI
EGLFKKNKVTYVKGYGKFISPSEISVDTIDGENKVVKGKNIIIATGSDVKSLPGITIDEK
KIVSSTGALALQEIPKKLVVVGAGYIGLEMGSVWGRLGSEVTVVEFGPDIVPSMDSEIRK
QFQRSLEKQGMKFMLKTKVVGVDTSGDGVKLTLEPASGGDQTSFEADVVLVSAGRVPFTS
GLDLDKIGVEMDKGGRILVNERFSTNVSGVYAIGDVIPGPMLAHKAEEDGVACVEFLAGK
VGHVDYDKVPGVVYTHPEVASVGKTEEQVKASGIAYRVGKFPFMANSRAKAIDNAEGLVK
ILAEKETDKILGVHIMASNAGELIHEAAIALQYDASSEDIARVCHAHPTMSEALKEAAMA
TYDKPIHI
Download sequence
Identical sequences MDP0000295277 MDP0000295277|PACid:22625688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]