SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000295839|PACid:22658517 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000295839|PACid:22658517
Domain Number 1 Region: 2-205
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.3e-43
Family FAD/NAD-linked reductases, N-terminal and central domains 0.039
Further Details:      
 
Domain Number 2 Region: 169-223,260-358
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000042
Family FAD/NAD-linked reductases, N-terminal and central domains 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000295839|PACid:22658517
Sequence length 463
Sequence
MEEVDVVIVGAGPAGIATSACLNHLNISNVVIEREDSYASLWRKRSYDRLKLHLAKQFCE
LPYMPFPPNYPRYLSKNEFVQYLEAYVSHFKITPRYDRVVETASYVGEKKWCVRVHNTLS
DVQEMYLAKFLVVASGENSEGYIPQVEGLNSFKGEFVHSSEYENGKKYDGKNVLVVGSGN
SGMEIAYDLTNWGANTSIVVRSPVHILTKEIVFLGMVLAKYLPLKVLDNIVVILGKLKFG
DLSKYGLTRPKLGPFFLKENEGQAPIIDVGSINKIIAGEIKVVPSITKILRNQIKFENGY
SNHYDAIVFATGYKSTVLNWLKDGDQLFNDNGMPKHSFPNHWKAEKGLYSAGFSRRGLFG
ISIDARNIADDISFALNQNKKIGKPAVAQNCNVADTINGEAEANLKRVRDEEGSDGNDAK
KMKVEKLPEEERLEEKLGEGXNSGRVRLGPKSFGXSVEMFDYF
Download sequence
Identical sequences MDP0000295839 MDP0000295839|PACid:22658517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]