SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000297581|PACid:22646099 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000297581|PACid:22646099
Domain Number 1 Region: 71-173
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000939
Family FAD/NAD-linked reductases, N-terminal and central domains 0.017
Further Details:      
 
Weak hits

Sequence:  MDP0000297581|PACid:22646099
Domain Number - Region: 206-230
Classification Level Classification E-value
Superfamily RING/U-box 0.0188
Family U-box 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000297581|PACid:22646099
Sequence length 250
Sequence
MEIIYTFLSNRHVKAQGVNCLKATSLRFSSINLCYSTSSSSPSSAFPSTATTAPVSVGRS
PQCRRKCYGDGRIRFQRSILDFEQRKRQLXYDETSGFWRVKTVTSTESTRSEVEYICRWL
IVAIGENAECVVPEINGLSEFGAEDMHTCEYKSGENFREKKVLVGCGNSGMEVSLDLCNI
RALSSLKGLKSKKSLSFKLHGGGGTAGVPKEFRCLISGELMADLVVLATGNDENGCITMD
ELATVIRSLD
Download sequence
Identical sequences MDP0000297581 MDP0000297581|PACid:22646099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]