SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000297861|PACid:22646554 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000297861|PACid:22646554
Domain Number 1 Region: 103-254,348-458
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.5e-35
Family FAD-linked reductases, N-terminal domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000297861|PACid:22646554
Sequence length 547
Sequence
MAGMVXVDPYVXLTFFAXLLGFLVLSVLRRRNYSKAKSKAQKNNNNTTNRRDGRENRRRI
EFERLREKKKDGEIEGRIQIEIEIRERLRHXLASVLEKPKYPREGRRVHVIERDLTEPDR
IVGELLQPGGYLKLIELGLEDCVEEIDAQRVVGYALFKDGKNTRLTYPLEQFNSDVAGRS
FHNGRFIQRMREKVAQLPNVQLEQGTVTSLLEENGTIKGVQYKPKDGQELKVYAPLTIVC
DGCFSNLRCTLCKPQVEVLSCFVGLVLENCRLPFANHGHVILGDPSPILFYQISSTEVRC
LVDVPGQRVPPIANGALANRLKNVVAPQVPPELHDAFIAAIDKGNIRTMPNRSMPASPHP
TPGALLLGDAFNMRHPLTGGGMTVALSDIVVLRDLLKPLHDLHDAASLCTYLESFYTLRK
PVASTINTLAGALYKVFSASPDEARTEMRQACFDYLSLGGFCSTGPVALLSGLNPCPLSL
VLHFFAVAVYGVGRLLLPFPSLKRVWLGARXLLSASGIIFPIIKAEGVRQTFFPATIPAY
HRAPPAE
Download sequence
Identical sequences MDP0000297861|PACid:22646554 MDP0000297861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]