SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000298218|PACid:22631518 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000298218|PACid:22631518
Domain Number 1 Region: 8-108
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.34e-21
Family B3 DNA binding domain 0.0027
Further Details:      
 
Domain Number 2 Region: 185-284
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.96e-20
Family B3 DNA binding domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000298218|PACid:22631518
Sequence length 361
Sequence
MASLRPTFSSTIPHFFKVILDDTSRDTKLKVPMKFVMKYGEELSSPVYLRLPCGSEWEIE
LRRCNGEVWFEKGWPEFSKFYSLDYAFWLVFGYEGNSRFHVFIFDRSCTEVDYPIKLPDK
EKTDYEDDESVEILDDFXTSRRRKGERYSSLPCPLPPKKKRKSYSRMHPLTEKDKAIALQ
RAIAFKSEKPHFKVAMQPSYIFGNLVNTLAQVLPAGFAKRHLMHQPHGNAILRLPDGGTW
CVKLKLYKQQKVRFKRGWLEFVRDNNLKTGDVCVFILIKGIELAFEVVFYRGEHDFSTMK
EVGGLSSSQIFQKRTPDVLGREHSLTKSEKALALQRANAFKSEYPSFPVAIQPSYIHSSY
L
Download sequence
Identical sequences MDP0000298218|PACid:22631518 MDP0000298218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]