SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000299953|PACid:22634985 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MDP0000299953|PACid:22634985
Domain Number - Region: 343-439
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000981
Family B3 DNA binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000299953|PACid:22634985
Sequence length 536
Sequence
HAIAYTGISQELYGARATINVWTPSIEQVNEFSLSQIWVLSGSFDGTDLNSIEAGWQTDS
YQATGCYNLLCSGFIQTNSRIAIGAAISPVSSYASNQYDVTILIWKDPKLGNWWMGFGDN
TLVGYWPAELFTHLADKATMVEWGGEIVNSRXNGEHTATQMGSGHFAEDGFGKASYFRNL
EIVDSDNSLSSVRDVSTLAENTNCYNIKSSYNNEWGTHFYYGEQASTSDSEDNKALHMHA
ILEINTPQLSEFCGEFYPGQKDRKLDYRSSSRRKDEYEYYKDCDEVLEEQPSMSMMKKKK
QKPAKKVASTKPSAPSIPSPIPELPNEFKEKIASLHGYQVQLVIQKQLFKTDLSSGHDRL
SMPVNQVINKNFLGEDDKRLNDNGLVYVKVIDPCLKVHDDLGLTKWKARNNDNFSYSLNR
GWKSISRDEGVGFKIGDTIQWLGLKKDVNAFTSSSIDRQEAAESSMTEKNEEWKKDTNGC
SNSSSVSASQEVIESSATMKPLESGATRQHVSIKFRNVTLAKLRLLFLFCRSFKFY
Download sequence
Identical sequences MDP0000299953 MDP0000299953|PACid:22634985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]