SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000300208|PACid:22651331 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000300208|PACid:22651331
Domain Number 1 Region: 224-543
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.21e-52
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00016
Further Details:      
 
Domain Number 2 Region: 569-686
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 4.81e-32
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0000632
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000300208|PACid:22651331
Sequence length 720
Sequence
TAKGNPPVTFGIAACETQNVSVSVLPCFGLSEGSTTTAKEMWNKMVQDGQFDRDNFNSGP
CMSSSPGETLCAAVAATAWVEPHGKCTVAFGLSWYKFTLFNELYFLVAGGTVXIDSPLPA
TNITNNRHQLTNVENTDVKVSEAEVNSNHNAAVEHTATGCQRSVHLDPQNASEDVGRRKQ
AWFCGLWVAMNVDRFSWIYSVIMSRKMLIDGEVNQPNEQEAHYDFDLFVIGAGSGGVRAS
RFSANFGAKVGICELPFHPVSSEVIGGVGGTCVIRGCVPKKILVYGASFGGEIEDARNYG
WEVNEKVDFNWKKLLQKKTDEIVRLNGIYKRLLSNSGVKFFEGEGKIVGPNDVEVTQLDG
TKLSYSAKHILIATGSRAQRPAIPGQELGISSDEALSLEELPKRAVVLGGGYIAVEFASI
WRGMGASVDLFFRKELPLRGFDDELRAVVARNLEGRGIDLHPQTNLTELVKTEDGIKVRT
DHGEELIADVVLFATGRSPNTKRLNLAAVGVEVDKTGAIKVDEYSRTNVPSIWAVGDVTN
RVNLTPVALMEGTCFAKTVFGGEPSKPDYRDIPCAVFCIPPLSVVGLTEEQAIEQAKGDI
LVFTSTFNPMKNTVSGRQEKTIMKLIVDAETDKVIGASMCGPDAAEIMQGIAIALKCGAT
KAQFDSTVGIHPSSAEEFVTMRSATRRIAAAALVDIRYCLIDCAFDSVSPFRRGIGFCTL
Download sequence
Identical sequences MDP0000300208 MDP0000300208|PACid:22651331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]