SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000302532|PACid:22624442 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000302532|PACid:22624442
Domain Number 1 Region: 16-114
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-19
Family B3 DNA binding domain 0.0024
Further Details:      
 
Domain Number 2 Region: 187-293
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.73e-18
Family B3 DNA binding domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000302532|PACid:22624442
Sequence length 294
Sequence
MASLSRRDDGDSPLPAKAPTFFKIVLDKALRDGRLEIPPAFVMKNEDCLADSVFLKDPTG
RVWRIELTRRCGKVWLQKGWSEFAKFYSLNHGYLLVFSHEGGFSHFLVRIFQRNTLEIDY
PISSSHDGVPMLCGGIQLPKNEEHGDNVSVKILDSPRPKTRSGGGMHTDEEKTTRLSDRA
FSRAVSFKSSNPFLVVKMQPSYIASQLRLSGSFVRRHICARGVCDMNLEISSRRSWPVKC
RVGVYRRKQYARVYDGWKAFARENRVKVGDACVFELINKGGTRSATFKVGVYRA
Download sequence
Identical sequences XP_008381043.1.92800 MDP0000302532|PACid:22624442 MDP0000302532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]