SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000305249|PACid:22629814 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000305249|PACid:22629814
Domain Number 1 Region: 150-251
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000294
Family B3 DNA binding domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000305249|PACid:22629814
Sequence length 531
Sequence
MATKITLDYVRKLQVESFTKMLAEVKAVAKNRDEELSMLEQKVLLDLFQNKGKKSTESKK
RKAASASNNQKIKKHNFGSSSRSMQDEYVYYKDCDEEDHEKKARTKKQKXAKKAESVKLS
SPSIPLPPPELPKEFKEKIESMHGFQVQLMIQKQLFKTDLSYGHDRLSMPRNQVVNKHFL
GEHEKRLENGRVLEVKVIDSGLKERKLWLAKWFTHTQSSFSYVLGRGWRTILKDEEVGLN
ENDVIQVWSFRYIDPNPDIKKEGLGFALVKIRGDXKKDFNXXTSIERQQVIESAITKKDV
NGSTSTDRQEAXVSQXIKXDEMETDANVSTGTEXXEPVDLAMIKKEEXKKDSICSTASEE
AIESSKAKNKSLQAAVKAMKHVSLNLNTCMAIYSIDSWLLPKAVRSYMPRDQVINKNFLG
QDDERLNNGVIYVRVVDPCLMVHDDLGLTKWVTQTKSSFSFALNKGWNSISTNKKLKKNV
NGGASTTDMQEAAESSMMKKDEEGKKDTNGCSSSRGASASEEVIESSTTKK
Download sequence
Identical sequences MDP0000305249 MDP0000305249|PACid:22629814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]