SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000308095|PACid:22667065 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000308095|PACid:22667065
Domain Number 1 Region: 62-427,540-581
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.14e-52
Family FAD-linked reductases, N-terminal domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000308095|PACid:22667065
Sequence length 614
Sequence
MASWALLPAAPVTGRCLVIPARTKRSSSFWVRSSLDTNVSDMRVNAPKGLFPPEPEFYRG
PKLKVAIIGAGLAGMSTAVELLDQGHEVDIYESRPFIGGKVGSFVDKKGNHIEMGLHVFF
GCYSNLFRLMKKVGADENLLVKDHTHTFVNKGGNIGELDFRFPIGAPIHGILAFLSTNQI
KAGFPIATMTDFTANHHHCHISLFWIPLLAELDFCYXISFITVQTYDKARNAVALALSPV
VKALVXPDGALQDVRNLDSISFSDWFLSKGGTRMSIQRMWDPVAYALGFIDCDNISARCM
LTIFTLFATKTEASLLRMLKGSPDVYLSGPIRDYIIAKGGRFHLRWGCREILYDKSSDGE
TYVTGFSMSRATNKKIVTADAYVAACDVPGIKRLLPSQWREWDFFNNVYELVGVPVVTVQ
LRYXGWVTELQDLERSRQLKQASGLDNLLYTPDADFSCFADLALTSPEDYYIEGXGSLLQ
CVLTPGDPYMPLPNEEIIARVTKQVLALFPSSQGLEVTWSSVVKIGQSLYREGPGKDPFR
PDQKTPVKNFFLAGSYTKQDYIDSMEGATLSGRQASAYICDAGEELVGLRKKLAAQDSGE
YTKAVNTTDELSLV
Download sequence
Identical sequences MDP0000308095 MDP0000308095|PACid:22667065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]