SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000309680|PACid:22638461 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000309680|PACid:22638461
Domain Number 1 Region: 640-736
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.05e-23
Family B3 DNA binding domain 0.0011
Further Details:      
 
Weak hits

Sequence:  MDP0000309680|PACid:22638461
Domain Number - Region: 190-252
Classification Level Classification E-value
Superfamily Peptidoglycan deacetylase N-terminal noncatalytic region 0.0955
Family Peptidoglycan deacetylase N-terminal noncatalytic region 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000309680|PACid:22638461
Sequence length 869
Sequence
MKGEKVQVQVPVLHHHQDLXAEDQEDTLGVDHGEMWLDDGQETALLADINDPSIFYNDHF
PPLPDFPCMSSSSSSSSTPAPVKPVTCSSSSSSSVSSSSSAASWAVLKSDAEPEDGERKR
QPNQNSYHHQHSQIDDQTVDAHALSSTASMEISQPLDLGGGGGGIDCMEETETFGYMDLF
EPNEFFYPSSIFQSDSLFMEQFQQDQDNQQLAMAQLLQDHHESATTIQSNPQQQKQVVGH
DEENTNKDLSNENKDPDDMAMVFLEWLRSNRETVSAEDLRSVKIKKSTIECAARRLGGGK
EAMKQLLKLVLEWVQTNHLQKRRSNSITTKDSNIITQQQYQDPFLNPNPNPSSRVFESNP
SRNFTQTQWMAPPPHAAAYDPAAGGLLIPTPPPAPPPPATYTSMIGYMAADPFGNGPSPY
QTSPEYHHHMIESGQPSWPSSPFGMGTAPYGSFPDNNIHLAPPQHHPQAFAGYGSQYQPY
QYFPGNGEHQLMRLGSSATKEARKKRMARQXRLVSHHRHHGHQQNSQQLNNQMPDHHHLQ
QTRLVGNTTDLNCTGAVPLQANPGNWFYWPTATAAPSPSAIAMMPSIMQEAAPLPPVQQM
DRPASTQAQNYNHGRSAVQERQERQERRQGWKSEKNLKFLLQKVLKQSDVGSLGRIVLPK
KEAETHLPELDARDGISIAMEDIGTSRVWNMRYRYWPNNKSRMYLLENTGDFVRANGLQE
GDFIVIYSDVKCNKYMIRGVKVRXAGPKSERQAGPKSEGNKRPGKSQRNQHASTPPGNNG
SSPSSATTAHKKERVNGSSGDNRDGNNIGGDGRDNEGGANSKWXWWRWWPRHRWPCDVSD
GATLVVAIGGGGDKGGNGGVVDRVILAVV
Download sequence
Identical sequences MDP0000309680 MDP0000309680|PACid:22638461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]