SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000309730|PACid:22638555 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000309730|PACid:22638555
Domain Number 1 Region: 11-258
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.95e-28
Family Extended AAA-ATPase domain 0.018
Further Details:      
 
Domain Number 2 Region: 353-600
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.04e-18
Family Thi4-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000309730|PACid:22638555
Sequence length 631
Sequence
FLKFVEKTAPVAVYTSGKGSSAAGLTASVIRDSSSREFYLEGGAMVLADGGVVCIDEFDK
MRSEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPPSGRYDDLKTAQDNIDLQT
TILSRFDLIFIVKDIRMYSQDKTIASHIIKVHASAGAALGDGRVVSKEENWLKRYIQYCR
TECHPRLSETASRELQSNYVKIRQDMRQLANETGEAAAVPITVRQLEAIVRLSEALAKMQ
LRHEATEEHVREAIRLFNAATMDAAKSGIQQQVNLTGEMANEVKQAETQIRRRVGIGNHI
SERKLIDELTRMGMNESTVRRALIIMHQRDEVEYKRERRRHRPPPSPSPSCVRYAVLGAG
FAGLSVAWHLLKQSPKDSNIRVDIYDEAGIGGGASGVSGGLLHPYSPKAKLLWRAADCWS
ESLNLLSAAEAAVASAAQXSDGPTPIVRRRGILRPALSLKNLVLLKDNAQSCLASCRIET
LDNDAAQNLVPGISPPLDASFYMPEAVNIHPQRYLQALFLACQNLVKELCASGSGVKELH
LHKSSIHKLLDLEGEYQAVIVCLGAKADMLPELCGRLPLRTCRGVVAHLQLPDDIGRKPQ
LQLLVIWRAWFTGIVVPWLAWEVDGTGCAFM
Download sequence
Identical sequences MDP0000309730|PACid:22638555 MDP0000309730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]