SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000309784|PACid:22654675 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000309784|PACid:22654675
Domain Number 1 Region: 382-481
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.53e-20
Family B3 DNA binding domain 0.0027
Further Details:      
 
Domain Number 2 Region: 1-90
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.3e-20
Family B3 DNA binding domain 0.003
Further Details:      
 
Domain Number 3 Region: 207-277
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000128
Family Calnexin/calreticulin 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000309784|PACid:22654675
Sequence length 619
Sequence
MQPSYIFNQLILPSEFAKRYLTQHPTGSVILRVPDGRTWNVKFKYENKRARFLLDWLAFV
EDNNLKIGDVCVFMLIKGFKITFEVAFYRSKEAAICSISSAAKECSGGLXTAQRGQEPFT
ISERSRAYKSSTSLDEPDYEDENEDSVEISDDFQRCTRKTREKSPLPSPQPLKKIRTSNK
AAKKCNINFRPTKIEPRSKFAVKKYEVDSIFYEPFSESFEGRWIVSSKDKYQGVWKLSKS
EGHDDYGLLVSEKARKYAVVKEMDKAVSLADGTVVLQSGSGYLKNNVPVKWVLLLVLRTH
LLLLRRYGQHAPPDELIRFSLSILGSRLKFLSGGDESDDDSVVFLDKFASCPKNFXKSLL
ASSTTSGKAIALERAIAFCSKSVNPSFWIVMQPSYVTQSYLYLRSEFTQRHLXMKSAGGN
AILKGPNXGTWSVKLKCENSKARFLQGWQAFVXDNNLEVDDVCVFTLMKDVKLSFEVFVF
GTTEAANCSMSPTGPSDTSFSAIXAAKKFVSSNPLLQSHPWSGVIPVFQLVFSKHFIEKK
KQIVTLRVDDRMWHCWKLARLVGGHEGVAPGQLCTRKSREKSLLTCLQPFKNIRTSSTGQ
EEKPNTAITISLLQNGERL
Download sequence
Identical sequences MDP0000309784 MDP0000309784|PACid:22654675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]