SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000309874|PACid:22623281 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000309874|PACid:22623281
Domain Number 1 Region: 184-393
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.00000000000622
Family Cystathionine synthase-like 0.012
Further Details:      
 
Domain Number 2 Region: 986-1075
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000001
Family B3 DNA binding domain 0.0063
Further Details:      
 
Domain Number 3 Region: 1169-1243
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000124
Family B3 DNA binding domain 0.0066
Further Details:      
 
Weak hits

Sequence:  MDP0000309874|PACid:22623281
Domain Number - Region: 762-859,898-926
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.00171
Family Cystathionine synthase-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000309874|PACid:22623281
Sequence length 1259
Sequence
MHLSVWKPISHCAALLMEKKTRRRRDNGSGLAVDAKRKPSVLRQLQENRLREALEEASED
GLLSKSQDIDSDQTPNQDGSFGRSRSLARLHAQKEFLRATALXADRTFSTEDSIPHLREA
FNKFLTMYPKFQSTEKIDHVRAEEYSHLSESLAKVCLDYCGFGLFSNLQTQLYWETCSFT
LSEITANLSNHALYGGAETGCVEHDIKTRIMDYLNIPENEYGLVFTVSRGSAFKLLAESY
PFGTNKKLLTMFDHESQSVNWMAQKAKEKGAKXYSSWFKWPTLKLCSRELKKQIANKKRR
KKDSATGLFVFPVQSRVTGAKYSYQWMALAQQNNWHVLLDAGSLGPKDMDSLGLSLFRPD
FIITSFYRVFGSDPTGFGCLLIKKSVMASLQSQGGRTGTGIVRILPVFPQCLSDSVDGLD
GLGGIENDAVNCNEELVPETNGESHMPAFSGVFTSNQVRDCFETEMDQDSDRDGASTIFE
EAESISIGEVMKSPIFSEDESSDNSYWIDLGQSPFGSDLSDQHTRQKTGSPLPPTWFSGR
KINKIFSPKVTPKPPKSPIYDDDKRANLRVHEDPGLSFDAAVLSVSHEPDRVKGIPEEEM
FAETDAASRNGREIPEEPEIREDLMANNSKLLXXEDGFRXNXQTXGLKHNNFENSSTSEI
CQESKDSAIRRETEGDFRLLGRRETKRFSGGRFFGLEEGDREPSMGHRLSFTIEDDHRGK
SSLILEPGETSMTILGDDEFMSEGEYGDEQEWERREPEIVCRYLDHVNMLGLNKTTLRLR
YLINWLVTSLLQLRLPGSHEGAEVXLVQIYGPKIKYERGAAVAFNVRRSXGRXXVHPEVV
QRLAEKNGISLGVGILSHVRIVDGPKQQHCGALDQADTSLCKPMVNGRQGGKNMFFXVEV
VTASLGFLTNFEDVYKMWAFVAKFLDSSFAEVERDELPSLXEESETTNSKYKLQPMASMD
SQPLYCDPELRWRAAIGPSMLYKHKHCIQLRLPPAFCRSLSGKKPKTALIKSCLGYWGVK
VGRSGDGNLAFEEGWEEFAKCNGLKEADNAVFEHKGDMAFNMVAYDSGGCEKEYPPDSGV
AANRMATSSKARNNKHHRGSKGKGLLKTTKWLTSRKQFKIKMAKSHGCVSKGYVHAFNRA
LGGVVKCAGVSFSFRILSQSGERLWQTTPARFARENGLHSISKLILNDPRGRLWPLSLGR
WGSRVKAADHRLAIKARGWCKFYASNGLKEGDVCLFKLKRMSRSISTAFMDVEITRRRS
Download sequence
Identical sequences MDP0000309874 MDP0000309874|PACid:22623281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]