SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000310875|PACid:22641004 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000310875|PACid:22641004
Domain Number 1 Region: 156-288
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.84e-40
Family B3 DNA binding domain 0.0035
Further Details:      
 
Domain Number 2 Region: 721-799
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000736
Family PB1 domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000310875|PACid:22641004
Sequence length 849
Sequence
MTSSEVSIKDNCGNPKGESFSSGFRDHNDARTVGEGQNGHSTVSDGRDAETALYTELWHA
CAGPLVTVPRERERVFYFPQGHIEQVEASTNQVADQQMPMYNLPSKILCRVINVSLKAEP
DTDEVFAQVTLLPEPNQDENAVEKEPPPPPPPRFQVHSFCKTLTASDTSTHGGFSVLRRH
ADECLPPLDMSRQPPTQELVAKDLHGSEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAG
DAFIFVRGENGELRVGVRRAMRQQGSVPSSVISSHSMHLGVLATAWHAILTGTMFTVYYK
PRTSPAEFIVPFDQYMESVKNNYSIGMRFKMRFEGEEAPEQKFTGTIIGTEDADTKRWRD
SKWRCLKVRWDETSTISRPERVSPWKIEPALAPPALNPLPMPRPKRPRTHMVPSSPDSSV
LSREVGSSKVNVDPAMPGGFSRVLQGQEFPTLRGNFAESQSDTAEKSVAWPPSIDEEKID
VVSASRRYGSENWMSSGRHEPTYTDLLSGFGNNVDSSHGICPPFVDQGVASANSMRKHSL
DQEGKYNSRSWSMLPSSLSLSLDSNQKGPLGNMSHQAQGNSRYGGFGDYSVVNGHRIELP
HGNWMMPLPPPSPFENPGNARDIMPRPQMLLDKREAVNPKDGNCKLFGIPLITPDPALLH
RNMMNESPRNNQAHTFESDLNSEKSRGLKSTDNLVAVSEPALQTSQQHIRDVQGKSQGGS
TRSCTKVHKQGIALGRSVDLTKFNNYKELIAELDMLFEFGGELMSPKKNWMIVYTDDEGD
MMLVGDDPWQEFCGIVRKIFIYTREEVQKMNPGTLNAQWEDNLSSGAEGVDAREGKSQPR
PSASTAEKC
Download sequence
Identical sequences XP_008374175.1.92800 MDP0000310875|PACid:22641004 MDP0000310875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]