SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000312598|PACid:22676419 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000312598|PACid:22676419
Domain Number 1 Region: 1072-1170
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.63e-22
Family B3 DNA binding domain 0.00089
Further Details:      
 
Domain Number 2 Region: 1337-1419
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.08e-18
Family B3 DNA binding domain 0.0053
Further Details:      
 
Domain Number 3 Region: 155-393
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.000000000000963
Family Cystathionine synthase-like 0.011
Further Details:      
 
Weak hits

Sequence:  MDP0000312598|PACid:22676419
Domain Number - Region: 763-859,898-926
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.000822
Family Cystathionine synthase-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000312598|PACid:22676419
Sequence length 1674
Sequence
MHLSVWKPISHCAALLMEKKTRRRRDDGSGLAVDAKRKPSVLRQLQENRLREALEEASED
GSLSKSQDIDSDQTPNQDGSFGRSRSLARLHAQKEFLRATALAADRTFSTDDSIPHLREA
FNKFLTMYPKFQSSEKIDHLRAEEYNHLSESLARVCLDYCGFGLFSNLQAQLYWETCSFT
LSEITANLSNHALYGGAETGCVEHDIKTRIMDYLNIPEHEYGLVFTVSRGSAFKLLAESY
PFGTNKKLLTMFDHESQSVNWMAQKAKEKGAKVYSSWFKWPTLKLCSRELKKQIANKRRR
KKDSATGLFVFPVQSRVTGAKYSYQWMALAQQNNWHVLLDAGSLGPKDMDSLGLSLFRPD
FIITSFYRVFGSDPTGFGCLLIKKSVMASLQSQGGRTGTGIVRILPVFPQYLSDSVDGLD
GLGGIENDAVHSNKELVPETHGGSHMPAFSGVFTSNQVRDCFETEMDQDSDRDGSTIFEE
AESISIGEVMKSPIISEDESSDNSYWIDLGQSPFGSDHSDQHMRQKTGSPLPPTWFSGRK
INKFFSPKVTPKSPKSPIYDDDDKRAHLRLHGDPVLSFDAAVLSVSHEPDHAKGIPEGDL
FAETDAASGNDREVQEEPEIREDSMANNSRLLSTEDGFRPNNQTSGLKHSNFELSSTSEI
CQESKDSAIRRETEGDFRLLGRRETKVFSGRRFFGLEEGDRELSMGHRVSFTIEDNHRGK
SSLISEPGETSMTTLGDDEFMSEGEYGDEQEWGRREPEIVCRCLDHVNMLGLNKTTLRLR
YLINWLVTSLLQLRLPGSDEGLEVPLVQIYGPKIKYERGAAVAFNVRQGSGRGLVHPEVI
QKLAEKNGISLGVGILSHVRIVDGPKQQHCGGLDLADTSLCKPMVNGRQGGKNMFFRVEV
VTASLGFLTNFEDVYKMWAFVAKFLDSSFAEVEGDELPPVPEESETTFWDTGMSKEYPPA
SGVVANRTATSSKAQSYKHRQCSIGKGLLKTTKWLTSRKQSKRKMAKTHGFVNKAYVTIP
APFARENGLRAEDCGRDFAKSRDIGGRETTLHVLQRALGGKLISMAEEARNVRSPHFFAF
YSADLSSERLKIPERFMRHMEGRTSGLVSLFGPSGSEWSVELIQQNGGLFLHRGWPAFVR
DHYVECGDFLIFRYDGDLCFTVLIFDQSACEKEAAFRFGYGQDSRNFDKYMYMGRKRRRE
EVASSGNKLVDGAVKKIRNGSSQFRSECIDEGREEATCSTEKNPLENPGLDVVSYKAKES
IQNMCGKGDGLNVNGRLCMQMSSAHEVAPSFSSSNPYFVRIIKSFNISGSYTLMELTTIT
QRLCPWFLIPSFRFGVWKMSTNIPYKFSVAHLPNCKVKIVLQNWKGESWTVNSVPSNRVH
TSHTLCGGWMAFVRYNDIQLGDICTFELVREFEFCVHIQKGETSSWLSPGLAVTTHKTIK
GLSKKMKGNSPKVLSKSIREIADKLSSKKDQDAAFINDTRKYGSTSRSLTKAALAQSKVA
SKKLVNRRKKVVDDELDSKSSGLRIKLTLDEERIARSFTSCFPNFVKIMKKFNISGSYTL
TIPKHVARARGLVSVAGLPSGETNASRSDRKIVACSTSCQGRSPSADGAGMWWQHLLACL
GFEVAIGLSSFSEKKAFLQTNDCVTEELNDHAFADTVKPKYFEWNRKTNRFRAP
Download sequence
Identical sequences MDP0000312598|PACid:22676419 MDP0000312598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]