SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000312748|PACid:22644976 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000312748|PACid:22644976
Domain Number 1 Region: 21-250,290-427
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.43e-31
Family FAD/NAD-linked reductases, N-terminal and central domains 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000312748|PACid:22644976
Sequence length 652
Sequence
MWRRSFSSTTGTAAATTALKDKKWDALVIGGGHNGLTAAAYLARSGLSVAVLERRHVIGG
AAVTEELVPGFKFSRCSYLQSLLRPSIIKYETQLEKFCEFMDPLLDSAPPESLQCESSCS
VSDRFKNKMHNSMFWARCLRQAAALGQKDFVEFMDLLLSPASKVLNNWFEAEVLKATLAT
DAVIGTTGSVHTPGSGYVLLHHVMGETDGERGIWSYVEGGMGSVSLAIANAAKEAGAHIV
TCAEVFMSLKELGLVHVSVLXLFASIVCLXDFVDYVFNLVLQVQQLLINDSGTADGVLLT
DGSQVHSSIVLSNATPYKTFKELVPDNALPPDFVRAIKYSDYSXGTTKINLAVDALPQFK
SCNLGHPDAGPQHVGTIHIGSESMEEINSACQDAVNGLPSNRPVIEMTIPSVLDKTISPP
GKHVINLFIQYTPYSPSDGHWGDTVYRESFARKCYSLIDEYAPGFSSSIIGYDMLTPPDL
EREIGLTGGNIFHGAMGLDSLFLMRPVKGWSNYRTPLKGLYLCGSGTHPGGGVMGAPGRN
AARVVLEDSSAVIPIKETLEARPRCDIKTANYRLRQAETDFGTSAVSCEFETLQLSSSYI
TWIMLGTLYEVEHGKLVFRAIEHKDDVQSCKVLVXKASILLKKGNDSDSRFE
Download sequence
Identical sequences MDP0000312748 MDP0000312748|PACid:22644976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]