SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000314333|PACid:22663787 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000314333|PACid:22663787
Domain Number 1 Region: 121-220
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.24e-24
Family B3 DNA binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000314333|PACid:22663787
Sequence length 510
Sequence
MARNVKNAKPQTPLSKEDGHLTQPPLPKPRLRPKPATNPKPSSLPTGKLKKPGKPKEQEV
EYSMPMKELSNTQITKQMLSHAGXSPAISNXQYDFPVDGSPSRGQAKSSAVIRAQEVRSK
LEPQFPSFVKSLVRSHVASCFWMGLPSLFCKSHLPDKDITMTLEDESGRQYQSKYIACKT
GLSSGWRQFAASHNLLEGDVLAFQLVEPTKFKVYIIRSNGLAEVDGDLXLPNLDNNTKQK
DAGKFINLSVYKDNAETSTXPCNDSTKKXAETSTTPWNDSNRKRAHSPQLVAPKKKKIGL
QRAKQSETDSEEVGSEVSEDLKSPVATLQFEDIRSYENFNILVDGLFLDPEFPEDVRRKY
YKLCRSQKAFLHENVIKGMNHNMIIGAISETVNIADSIEACKVTALRDDFVSWDKYLTAF
ELLGMNVGFLRERVCRLANLADXSEAAVEAKMFKEATIERSQAGIGLRNIEMKLEELMEA
CDEFGAAIESLRSKXEINKLRFQEEVTAPW
Download sequence
Identical sequences MDP0000314333|PACid:22663787 MDP0000314333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]