SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000314335|PACid:22679828 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000314335|PACid:22679828
Domain Number 1 Region: 161-230
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000148
Family Thioltransferase 0.011
Further Details:      
 
Domain Number 2 Region: 24-94
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000153
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000314335|PACid:22679828
Sequence length 231
Sequence
MSKVHLRLYMKDSEPKIQDETSKERMLRIPREDEFWSRGISACAICDGASPLFKGQVLAV
VGGGDTATEEALYLKKYARHIHLLVRRDQLRASRAMQDRQAVTAAGSGCIAALSVERYLV
GKDLIIEFHQPVTEEAKKEPSSMDVQEGFDITLTKHRGQASPTCGPCRTLKPILGTVIDE
FDHNVHFVEIEIEEDPEVVEATGIMGTPCVQFFKNKEMIRTVSGVKMKSEY
Download sequence
Identical sequences MDP0000314335|PACid:22679828 MDP0000314335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]