SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000315388|PACid:22681954 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000315388|PACid:22681954
Domain Number 1 Region: 314-421
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000647
Family FAD-linked reductases, N-terminal domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000315388|PACid:22681954
Sequence length 455
Sequence
MVTTAQLALTQSPISSLIPCVSNTMIVKLDDFNYVTWNFQMELLLDSNEIKGFLDGSIPY
LAQFDNSANDGETVENNQSFSYAYKVWMIYNQALMTLITATLSTVALSCVIGYKSLEEIT
NIMQMKIDLQNIKKGPENINAYLQRIKDARDQLAIIGRENLVSLKELRSRLKVEESTLDE
TTKQIPLTSAMHARTSGSIFYNGSSSCTKPYIPGSDVGSASGGNSGFPPTIHPQFASPGM
YIMPYANQNGMSSEYMSNPSMPQPNSHVPMSARTQVSPFAPQQEYWLVDSRETNHMIYDL
SNLHMVTPYISSNTVTGANSEGLSAIGIMYSDSNGRSHCAFVRSKAEVLLSASAIGSHQL
LQLNGIGPESYLSSLKIPVISPHPYIRQFMYDNPRNLINILPPFPLERSPLKIVGITSDF
YIESISASPFSTPPFIVFPNPPNPSNLLGYNHPLT
Download sequence
Identical sequences MDP0000315388|PACid:22681954 MDP0000315388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]