SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000315774|PACid:22650922 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MDP0000315774|PACid:22650922
Domain Number - Region: 1-60,92-126
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.011
Family FAD-linked reductases, N-terminal domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000315774|PACid:22650922
Sequence length 165
Sequence
VVEKSKAFSNHPQAHFINNRSMEVFRKLDGLAEEIQRSQPPVELWRKFLYCTFLYGSILG
QSTICNPKICGQIIFKLIGRELGDINVIDIKPWVMHAEVAEKFLSCGNRIILAGNAAHRF
PPAGGFELSIQNFRAAMAVPAVLGLDPTTANSVTNFLLELQYIAS
Download sequence
Identical sequences MDP0000315774|PACid:22650922 MDP0000315774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]