SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000316701|PACid:22677141 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000316701|PACid:22677141
Domain Number 1 Region: 16-114
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.04e-23
Family B3 DNA binding domain 0.0038
Further Details:      
 
Domain Number 2 Region: 201-300
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 8.63e-22
Family B3 DNA binding domain 0.0032
Further Details:      
 
Domain Number 3 Region: 359-456
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.22e-16
Family B3 DNA binding domain 0.0066
Further Details:      
 
Domain Number 4 Region: 509-559
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000563
Family F-box domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000316701|PACid:22677141
Sequence length 562
Sequence
MASLLPETDRARPTFSATTPHFFKIIPNEASRYTKLRIPEKFVNKYGENISNPILLKLPS
GVEWEIQVRTCNGDIWFDKGWPEFSEFYSLDYGDSLVFRYEGNSKFHVCIFDRSATEIEY
PLPFPEVEESDEDDDESFKVLEDFPPCPRTRQKSPLPCPLPRMKKRISTSSSKKFGNKSS
SRRHPLTKNEKSIALQRCIDFKSEKPHFKVVMQPSYIFHNLILPSEFAKRHLMQQPTGSA
ILCVPDGGTWRVKFTYANQISRFLCGWLAFVGDNDLRVGDVCVFILIKDIPLSFEVVFYR
GKCKMGKINGRHVSQRPCTSSLSASEVANMSKISNQVTQRPSCLKASRVLEAANKFITKN
PFFRATVRPPSKLMHVPAEFAKRLKLQKKQIAALRVGEQLWPVNIIGYNNEGSRHSHISG
GWRVFAEENRLREGDVCTFELVEINDIVLKVHIFRRRFGLAGCNRSMKRASLGDDSMAAA
SSADVKMKRIKVEEEEEEMVIDYVDQDKLKGAGFSNLDDNLIFKVFKHVDTRTLGMASCV
SKQWHKMAEDERLWELICPCTS
Download sequence
Identical sequences MDP0000316701 MDP0000316701|PACid:22677141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]