SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000319957|PACid:22645199 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000319957|PACid:22645199
Domain Number 1 Region: 234-378
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.31e-48
Family B3 DNA binding domain 0.0061
Further Details:      
 
Domain Number 2 Region: 26-115
Classification Level Classification E-value
Superfamily Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin 8.93e-21
Family Plant lipid-transfer and hydrophobic proteins 0.0004
Further Details:      
 
Domain Number 3 Region: 843-919
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000137
Family PB1 domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000319957|PACid:22645199
Sequence length 975
Sequence
MKGVVIAAVVVVLAMLVLVEPGHATVTCQQAMSSVTPCLQYLTSGSGTPPVACCSGVSGL
RQLTQTTEDRRTACQCLMDAANQNQDIKEAAAXGLPAACRVQINVPISRSVDCNNGGGGG
AGHVGLGRTREXQGPLRGSSDSSQARANKLSQAQSSSLSAVKSELLKMSLSAQLLHQPTK
KWMPTFPITPNLPPQLICQLHNVTMHADVETDEVYAQMTLQPLNPQEQKDVYLLPAELGA
ANKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDYSQQPPAQELIARDLHDNEWK
FRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPSS
VLSSDSMHIGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMRF
RMLFETEESSVRRYMGTITGISDLDSVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEP
LTTFPMYPSPFPLRLKRPWASGVPSFHGLKDGDMGINSPLMWLQGGLGDQGMQSLNFQGF
GVSPWMQPRLDASMAGLQPDVYQAMAAAALQEMRAVDSSKCSSQSLLPFQQSSSVSNGAA
AVLQRQVLPQSQPQNAYLESFQESQAPAQAQHQIPNXMSALPNFASITPSQSASMQSISS
QPQQQSFPDPVGNPIPSSDVPPVHSMLGSLSQDGTSHLLNLSGSNSAISSSLLAKQTTGE
PQLSSGAAQCVLPQVEQLRTPQSSFSEITALPPFPGREYSAFQGGTDPQSNLLFGVNIDS
SSLMLHNGIPNLRNIGNGNDSVSVPFGASNYASGTGNDFPLNSDMTTSSCVDESGFLQSS
ENVDQVNPTGTFVKVHKSGSFGRSLDISKFSSYDDLRSELARMFGLEGQLKDPQRSGWQL
VFVDRENDVLLLGDDPWQYSRLWKCKQMGKEGLNSVASVPNNKLSNGSNTTVDYVGRQDL
RNSRNGIASLGSLDY
Download sequence
Identical sequences MDP0000319957 MDP0000319957|PACid:22645199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]