SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000320202|PACid:22645082 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MDP0000320202|PACid:22645082
Domain Number - Region: 50-90
Classification Level Classification E-value
Superfamily TSP9-like 0.0942
Family TSP9-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000320202|PACid:22645082
Sequence length 114
Sequence
KVRKLQTEFQANELRKQIVSCVQRFRVGEVCERKMSKKNDLARRKRQHEFELKREKEERE
KKAKKLQAKKSKMKVDGNEKKKKGGGFKVGKKKFKTKMTALNKAKAAQAMEVDK
Download sequence
Identical sequences MDP0000320202 MDP0000320202|PACid:22645082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]