SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000320539|PACid:22651795 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000320539|PACid:22651795
Domain Number 1 Region: 7-210
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.52e-36
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0075
Further Details:      
 
Domain Number 2 Region: 165-331
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.13e-29
Family FAD/NAD-linked reductases, N-terminal and central domains 0.001
Further Details:      
 
Domain Number 3 Region: 336-416
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000000000989
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000320539|PACid:22651795
Sequence length 480
Sequence
MGRAFVYVILGGGVAAGYAALEFTKRGISHGELCIISEESVPPYERPALSKGFLLPEAPA
RLPSFHTCVGANEERLTAKWYKEHGVELVLGTRVKSVDVRRKTLLTGSGETISYKILIIA
TGARALKLEEFGVKGSDSENVCYLRDLADANRLVNLMESSSGGNAIVIGGGYIGMECAAS
LVISRMNVTMVFPEEHCMARLFTPKIASFYEEFYKSKGVKFVKGTILSSFDIDSDGKVTA
VNLRDGSSLPADMVVVGIGIRPNTSLFEGQLTLEKGGIKVNGRMQSSNSSVYAVGDVATF
PVKVFGESRRLEHVDSARKSARHAVTAIMEQHQADEFDYLPFFYSRVFTLSWQFYGDNVG
DVVHFGDFSGGTFGAYWVKKGQLVGSFLEGGTKEEYEAIAKATKLKPEVEDLEELERQGL
RFAVTVSQEPPPSSPPPHDVISSGIVLERPIYAFHATAGVVVAASIAAFAYWYGRKRRRW
Download sequence
Identical sequences MDP0000320539 MDP0000320539|PACid:22651795 XP_008341454.1.92800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]