SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000320742|PACid:22645070 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000320742|PACid:22645070
Domain Number 1 Region: 219-518
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.15e-40
Family G proteins 0.00049
Further Details:      
 
Domain Number 2 Region: 691-893
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.55e-25
Family FAD-linked reductases, N-terminal domain 0.00023
Further Details:      
 
Domain Number 3 Region: 136-209
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000305
Family G proteins 0.0066
Further Details:      
 
Weak hits

Sequence:  MDP0000320742|PACid:22645070
Domain Number - Region: 554-595
Classification Level Classification E-value
Superfamily Probable GTPase Der, C-terminal domain 0.00889
Family Probable GTPase Der, C-terminal domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000320742|PACid:22645070
Sequence length 915
Sequence
MSHSCIRSLPALKKKFGFGLLHNPLQSSTNTIPNLYIERQKHSNNFGSLFTAAFLSPFGN
PTLRFRAQCRSISILHPFILQATGELCTLPTYQLPASDTCKGTAVHLEEPHVDSDCKVTA
EKTRGLYKKPVDFTKVNKNLLPTVVLVGRPNVGKSALFNRLIRRREALVYNTPDDHVTRD
IREGIAKLGDLRFRVLDSAGLETAASSGSILDRTSGMTASVLARSQFAVFLLDVRAGLHP
LDLEVGRWLRKNAPGINLVVAMNKSEALFDGSGSLMTAATEAYRLGFGDPIAISAETGLG
MQDLYESLKPKLEDYMLQVLNNEEGTAEDGSSCDVEESKLELQLAIVGRPNVGKSTLLNT
LLQEERVLVGPEAGLTRDSIRAQFEFEGRTVYLVDTAGWLQRAKQEKGPSSLSIVQTRKN
LMRAHVVALVLDAEEIANSRRSLKHDEVVIARQAVEEGRGLVVVVNKMDLLRGKQLFDKV
MEIVPQEIQTIMPQVTGIPIVFISALEGRGHADVMHQVIDTYEKWCSRLSTARLNRWLRK
VMSRHSWKDQAAQPKVKYFTQVKARPPTFVAFLSGKKELSETDIRFLKRSLKEDFDLGGI
PIRIMQRKPSSSSSFLSSISPSPSNPFSSSPKTTHIPNGGYLYVQLLGRNFASLRSQIGS
RPEVSSGYCQNWVNVRANGTLGSQTRSLCSEPDRESIQYDVVIVGAGPAGLSAAIRMKQL
CREKDVDLSVCVVEKGAEVGAHIISGNVFEPRALNELLPQWKDEESPITVPVTSDKFWLL
TKDRALSLPSPFDNRGNYVISLSELVRWMGVKAEELGVEIYPGFAASEQIMKKYNLREKG
HSQHQTYALGIKEVWEIDEGKHEPGAVLHTLGWPLDPKTYGGSFLYHMKDRQISIGFVVA
LNYHNPFLNPYEEFQ
Download sequence
Identical sequences MDP0000320742 MDP0000320742|PACid:22645070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]