SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000320748|PACid:22658808 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000320748|PACid:22658808
Domain Number 1 Region: 53-225,312-422
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.64e-43
Family Thi4-like 0.068
Further Details:      
 
Weak hits

Sequence:  MDP0000320748|PACid:22658808
Domain Number - Region: 549-616
Classification Level Classification E-value
Superfamily Kix domain of CBP (creb binding protein) 0.00353
Family Kix domain of CBP (creb binding protein) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000320748|PACid:22658808
Sequence length 1635
Sequence
MVYEYVLAXVLVSLLSSVFFVFINTTYGDKKDXDVANVSATGVFLTPEIEKSTDVVIVGA
GVAGAALAYTLGKEGRRVHVIERDLSEPDRIVGELLQPGGYLKLIELGLEDCANDSIDAX
KVFGYALYKNGNDTKLSYPLETYSSEIAGRSFHNGRFIQRMRERAAALPNVKLEQGTVTT
LLEEKGTIQGVMYKNKAGEEMXTYAPLTIVCDGCFSNLRRSISSPNIENPSCFVGLILEN
CELPHANHGHVILGDPSPILFYPISSTEVRCLVDVPGTKXPSVANGEMAQYLKTVVAXQA
FLAAVDXGIIRTMQNKSMPAAPQPTPGAILLGDAFNMRHPLTGGGMTVALSDIVLLRDLL
RPLSDFNDAPALCXYLESFYTLRKPVSSTINTLAGALYKVFCTSPDPARQEMREACFDYL
SLGGVCSNGPISLLSGLNPRPISLFLHFFAVAVYGVGRLMIPFPTPKRLWLGARLILSAS
GIIFPIIKAEGVRQMFFPATMPAYYRVPPVRTKIETSTKYTLRSTNLYXISXCXXKKHAQ
AELNMDPVNWRTKFPAESREKVVNKVXSTLMKRVPFSEHEKHMSDYKRISVNFEEXVYMV
SRDQQEYILRIKSKLEELESSPKNLNPGGAQGQSISVQSTAPSQAHEQHSLPSVRDNIAS
GGGFTNLASAKPTVSVTPQVPLPNNASENSNTQNVFGNSQRSVRNLSGRGQPYNITANNM
RQEQGRQNSPQIVAQQNHEXQNPHLCKQVWQENISPSYVTQQKQLQPQHHYQQKLLKPTQ
QQTSQQSMLQTPVMRXSETCVSPLSDIWQDPMSSFYQTTQLRIKNQSQIAFRQTNQSQVT
PDIHQNKTNLSSAXHEQLGERNNISVLQQSSQLPNKDQXPQPHSLERRLNTQTQPEKMKQ
LPNPSAQDQQQAYQTSGTLTSTSEGRVSCTDNGQEEAYQMLQSLKSKYLIPLADMYKTIT
CRLQQLNSVSQQTETVGIEKLNALRNRVKSIISNLNLPKSKVAPSSKENLGVYEKFITSI
LSVRGRGNSGPSEQHGQRSSDVNSTRQFMQLHSQTPPVQTQQDEKKSTFQSVNSQDSATT
MQRSNATNLVNDSKSVSECPTLQPTDTYSGKIGSFNIVXQVSSGTLNIPKTNLQQPNVKT
LLSHSPVXGPQSXVNAFESSCNTFQEMHLKQPKEERDVQAQTLKQEPQDWHEMLQQSVQK
QIVQQHSRLLKFQSXASFPTALPKTHGSSXSQVPRCSTIDKKNLLVPFTEARTTFYPINT
PSTKTCLVPLPSSSVPGDFEMPMSDTSSLSNAGTIGDHMVDGAPKSTSPIAISTPGISAS
FLLEESSNDIHCNTSTIMSDELSASKQPIQRLVKVVNMMSSKALSAAILDIGSVVCTTDR
LSXSAXLMGXRGSVGXXXVGMTNSRLQKSYLAWQDKXFGTKNMKRXRSTSPINVDASATG
SIYDSSRLSDTEIFDLESTAISYIKRPRIEVNQTLFEEITAINHQLIDTVLDVSDEDTPP
TVVSAQFRGGQGTIVXCSFIPVTIDPSLRSQHPSAQMLPIQPLRLLVPANYPLCSPIFLD
KLRVEVGDELEDFSAKVKSKLNMSLRRLMEPLSLGEIARTWDICVRAVVAEYAEQNGGGN
LSSKYGGWEDCMSAA
Download sequence
Identical sequences MDP0000320748|PACid:22658808 MDP0000320748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]