SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000320804|PACid:22671446 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000320804|PACid:22671446
Domain Number 1 Region: 1-257
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.85e-39
Family FAD/NAD-linked reductases, N-terminal and central domains 0.031
Further Details:      
 
Domain Number 2 Region: 357-508
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000356
Family FAD/NAD-linked reductases, N-terminal and central domains 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000320804|PACid:22671446
Sequence length 510
Sequence
MGKQVAIIGAGISGLLACKYTLSKGFHPIVFENSSSIGGVWTKTVETTKIQTPKEFYQFS
DFPWPSSVTEGHPDQNQVLNYIQSYAQHFDLLKHIKFNNKVSGIEYEGPSGDEMQAWSHW
GGTGEPFSSGGKWKVVVEDKQSLSTKIHVVDFVILCIGRFSDVPNIPEFPPNKGPEAFHG
EVIHSMNYADMDYESAAKFVEGKQVTVVGFQKFAMDIAMECSNTNGVANPCTVLYKTEHW
NLPDYLPWGFPIAYLYFNRFSELLVHKPGEGILLSLLATILSPVRWGFSKFVESYINKKL
GLAKYGMVPKHSFLQEISSCMIATVPEKFFDRVREGSIILKKSPCGFGFCQEGILVNGES
SPVKSDLIILATGFRGEKKLKDMFVSPTFQDYILGSPKSILPPLQLAVIGFSESISNLYT
SEMRCRWLAELLGGTFKLPXIKEMEKDVEKWDAYAKRYASSQYYRRSCIGALHLWYNDQL
CKXMGWNPKRKKGLFAELFEPYGPMDYASS
Download sequence
Identical sequences MDP0000320804|PACid:22671446 MDP0000320804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]