SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000321569|PACid:22635836 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000321569|PACid:22635836
Domain Number 1 Region: 162-264
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.32e-27
Family B3 DNA binding domain 0.0000249
Further Details:      
 
Domain Number 2 Region: 31-86
Classification Level Classification E-value
Superfamily DNA-binding domain 0.000000000000785
Family GCC-box binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000321569|PACid:22635836
Sequence length 508
Sequence
MDTMSCWNASTSDYSTMNGANGARSNKLPSSRYKGVVPQSNGRWGAQIYDKSHRVWLGTF
NDEEEAAKTYNIALLKFRGLDAITHLSRSQMKPYGRDVTEALFLESHSKAEIIDMLRKHS
YANELEMYKHKLHNGXALGLDDGGKRTKCYLXLMDTCSRERELLFEKVATPSDVGRLNRM
VIPKQHAEKHFQVHLSVGFGKGVLLKFEDELGKVWRFGYCYWSSSQSYVLSKGWIRFVKE
KKLKAGDIVMFQRSVGEDKKLFIECRPRKVDVSRIEEMHGRVAGPLATVQDDGVICGVVL
RLTHKRMVKPRLQTAPWVTCVVHSVTGKSPFSLVYTXVPKHVVGLIKLPTGPSGXVAAEK
MAKSIQAIKAKVCERLAQTYAKYKAVVDQHRGSHVFQVGDAVMVFFRKERFPVETYSKVK
PRKYGPYKILQKINDNAYVVDXPSSMSISPTFNVANLFDHTASKATQKNRERETAMASLA
QQFIGLRVKMLTALHLEALEALNPAEAK
Download sequence
Identical sequences MDP0000321569 MDP0000321569|PACid:22635836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]