SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000362000|PACid:22628256 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000362000|PACid:22628256
Domain Number 1 Region: 47-112,156-178,215-229,277-388
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.11e-22
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000362000|PACid:22628256
Sequence length 485
Sequence
PFSXTLLSRFSSEPARPSPIHETPAPTPTPQPPTFYSGLGPTMPGDKPRVVVLGSGWAGC
RLMKGLDTEQYDIVCVSPRNHMVFTPLLASTCVGTLEFRSVAEPIARIQPAISRETGSYF
FLSNCIGLDPDKHXVKCETVTDGAEPLKPWKFEIAYDKLVIALGAMPTTFGIQGVHEHAI
FLREVSHAQEIRRKLLLNLMLSDVPGVSEEEKSRLLHCVVVGGGPTGVEFSGELSDFIQR
DVQERYAHVKNYIHVTLIEANEILSSFDDRLRHYATKQLTKSGVRLVRGIVKDVKDKKII
LNDGTEVPYGLLVWSTGVGPSPLVNSLPLTKSPGGRIGVDEWLRVPDVQDVYSIGDCSGF
VESTGKPTLPALAQVAERQGKYLANLLNKIGKAGGGRANAAREYKYEEPFVYKHLGSMAT
LGRYKALVDLRQSKAGKGVSMAGFFSWFVWRSAYLTRVISWRNRFYVAINWLTTFVFGRD
ISRIX
Download sequence
Identical sequences MDP0000362000 MDP0000362000|PACid:22628256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]