SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000382202|PACid:22682839 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000382202|PACid:22682839
Domain Number 1 Region: 187-305
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000942
Family B3 DNA binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000382202|PACid:22682839
Sequence length 397
Sequence
MARLLSAKYFDGLTEWPQNFTKFDWLVTIAGVEVEMHTQEEKLMERKRETLMKEKALKQP
MLVEPPKKQRSPPIGSTRTDYSLKRKWASNSINDDRAPKIQRSCGGPKIIFQSMYRGDDD
LGRGDLGCKKQNVMPKDKVKKAKGSTKNSLKTKEPIGSPSTPPKYHDLPDEFKSEIARLE
GTRLSLVIQKPLTMTDVNQNDNRLSMPEAQIVSMDFLEGAEKELLKENQTMSVQLIDPGL
VKGGINLRRWHMKKKPDNNSSKPEKNGSIIYVLRTQWGAVAKRNKLKPGQLVQVWSFRVN
GALYLALVLVKESRGEGDHKESDGGHSGGKSGVVEGETSGSSTGIGGSGGGSEIMEEKKD
DNNGNASGASTVINGSDHASPNRSGSRKEDADVEPKL
Download sequence
Identical sequences MDP0000382202 MDP0000382202|PACid:22682839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]