SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000412781|PACid:22651617 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000412781|PACid:22651617
Domain Number 1 Region: 156-277
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-44
Family B3 DNA binding domain 0.0034
Further Details:      
 
Domain Number 2 Region: 692-775
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000422
Family PB1 domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000412781|PACid:22651617
Sequence length 824
Sequence
MEIDLNHAVREVEKNAYCNGDCGGVCVYCLSSSTSSSSSNSSSAPVASSIYLELWHACAG
PLISLPKKGNVVVYFPQGHLEQVASSSPFSPMEMPTFDLHPQIFCKVVNVQLLANKENDE
VYTHVTLLPQPELVGTNLEGKELEELGVDEGDGGSPTKSTPHMFCKTLTASDTSTHGGFS
VPRRAAEDCFPPLDYKQQRPSQELVAKDLHGVEWRFRHIYRGQPRRHLLTTGWSIFISQK
NLVAGDAVLFLRGENGELRLGIRRAVRPRNGLPDSVVGNQNSYPSVLSFVANAISTKSMF
HVFYSPRASHAEFVIPYQKYVKSITNPVTXGTRFKMRFDRDDSPERRCSGVVTGITDLDP
FRWPNSKWRCLMVRWDEDIGNDHQERVSXWEVDPSVSLPPLSIQSSPRLKKLRTSLQGTP
PIPSITGTILPNNIASIFYIIIXPQYVNFLAAGGAGFKDFEESVKSSKVLQGQENIGFIS
PLYGXDTVNXPQDFEMHAPAHLSLASNATQKATIDELMRARRTPYTGFAESDRFPKVLQG
QEICPLRSLTGKANFTLGDWESNNGCAPFNVYQPPKPNYFSLASGSLPNMYFPYGDXHRA
GQDPTMCSNATNLPREKMQINPYSMQXGVARNEVGRPNKPCEHKTQESTSTLPALVPNPR
NPNDKDYNGTVTGCKLFGFSLTGDNPSPNSQSSSKRSCTKVHKQGSLVGRAIDLAKLNGY
GDLLTELERLFGMXGLLRDSDKGWRILYTDSENDMMVVGDDPWHEFCNVVSKIHIYTREE
VEKMTIGMISDDTQSCLEHAPVMLEVSKSSSVSQPDSSPTAIRV
Download sequence
Identical sequences MDP0000412781|PACid:22651617 MDP0000412781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]