SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000433167|PACid:22632081 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000433167|PACid:22632081
Domain Number 1 Region: 11-64
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.000000000000127
Family Toll/Interleukin receptor TIR domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000433167|PACid:22632081
Sequence length 98
Sequence
MALVRAAQGTSSDSNTHWGYRYDVFLSFRGEDTRRTFTDHLYTALNNAGFLTXRDDDELE
RGEISSXDYRKQSGNQKRLLSCFRKXXRHPDGALMSLS
Download sequence
Identical sequences MDP0000433167 MDP0000433167|PACid:22632081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]