SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000442206|PACid:22660061 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000442206|PACid:22660061
Domain Number 1 Region: 567-1331
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 6.41e-253
Family FMN-linked oxidoreductases 0.00000000000482
Further Details:      
 
Domain Number 2 Region: 91-525
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.93e-148
Family Class II glutamine amidotransferases 0.00000000943
Further Details:      
 
Domain Number 3 Region: 1348-1611
Classification Level Classification E-value
Superfamily Alpha subunit of glutamate synthase, C-terminal domain 1.23e-95
Family Alpha subunit of glutamate synthase, C-terminal domain 0.000000845
Further Details:      
 
Domain Number 4 Region: 1815-2155
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.33e-61
Family FAD-linked reductases, N-terminal domain 0.086
Further Details:      
 
Domain Number 5 Region: 1671-1828
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 1.1e-37
Family Dihydropyrimidine dehydrogenase, N-terminal domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000442206|PACid:22660061
Sequence length 2191
Sequence
MLASTGGSVVQLRTKPSLLPSCSPSRKSCKALAKKFFGTRLRASGSERLHLWRSDGPGRS
PKLRVVVRNMLSAVPEKPLGLYDPSFDKDSCGVGFVAELSGEGSRKTVRRRITDAIEMLV
RMTHRGACGCETNTGDGAGILVGVPHDFYKEVTKDAGFDIPPAGEYAVGMFFLPTSESRR
EESKRVFAKVAESLGHTVLGWRSVPTDNSDLGNSALQTEPVIEQVFLTATPKSKVDFERQ
MYILRRLSMVAIRAALNLEHGGAKDFYICSLSSRTVVYKGQLKPVQLKGYYYADLGNERF
TSYMALVHSRFSTNTFPSWDRAQPMRVIGHNGEINTLRGNVNWMKAREGLLKCKELGLSE
NDLKKLLPIVDASSSDSGAFDAVLELLVQAGRSLPEAIMMMIPEAWQNDKNMDPDRKALY
EYFSSLMEPWDGPALISFTDGRYLGATLDRNGLRPGRFYVTHSGRVIMASEVGVVDIPPE
DVSRKGRLNPGMMLLVDFENHVVVDDEALKQQYSLARPYAEWLQRQKIELKDIVDSVHES
DRVPPSIAGVIPASTNDETMENMGIHGLLAPLKAFGYTVESLEMLLLPMAKDGVEALGSM
GNDTPLAVMSKREKLTFEYFKQMFAQVTNPPIDPIREKVVTSMECMIGPEGALTETTEEQ
CHRLSLKGPLLTIDEMEAIKKMNYRGWRCKVLDITYSKGRGREGLEETLDRICSDAHEAI
KKGYTTLVLSDRAFSPKRVAVSSLLAVGAVHQHLVKNLERTQVGLIIESAEPREVHHFCT
LVGFGADAICPYLAIEAIWRLQVDGKIPPIANGAIYSKDELVKKYFKASTYGMMKVLAKM
GISTLASYKGAQIFEALGLSSEVIERCFAGTPSRVEGATFEMLAHDELHMHELAFPSRSY
PPGSAEAVALPNPGDYHWRKGGEVHLNDPVAIAKLQEAARTNSVAAYKEYSKLIHELNKA
CNLRGLLRFKNTEQQIHLDEVEPASEIVKRFCTGAMSYGSISLEAHSTLAIAMNRIGGKS
NTGEGGEQPSRMEPLPDGSRNPKRSAIKQVASGRFGVSSYYLTNADELQIKMAQGAKPGE
GGELPGHKVIGDIAVTRNSTAGVGLISPPPHHDIYSIEDLAQLIHDLKNANPAARISVKL
VSEAGVGVVASGVVKGHADHVLISGHDGGTGASRWTGIKNAGLPWELGLAETHQTLVSND
LRGRTTLQTDGQLKTGRDVAIATLLGAEEFGFSTAPLITLGCIMMRKCHKNTCPVGIATQ
DPVLREKFAGEPEHVINFFFMIAEELREIMAQLGFRTINEMVGRSDMLEVDREVTKNNEK
LDNIDLSLLLRPAADLRPGAAQYCVEKQDHGLDMALDHKLISMSKAALEKALPVYFETPI
CNVNRAVGTMLSHEVTKRYNRAGLPADTIHIKFSGSGGQSLGAFLCSGIMLELEGDSNDY
VGKGLSGGKIVVYPPKGSRFDPKENIVIGNVALYGATSGEAYFNGMAAERFCVRNSGAKA
VVEGVGDHGCEYMTGGTVVVLGKTGRNFAAGMSGGIAYVYDVDGQFRSRCNPELVDLDTL
EEEDILTLQMMIQQHQRHTNSLLAVQVLADFENLLPKFIKVIPREYKRVLADMKEETKQV
IEHKEEDEPELEEKDAFQELKKLAAASLNGKSNQKVEDAEALKRPSQVTDAVKHRGFIYY
EREGVQYRDPNVRMNDWKEVMEETKPGPLVKTQSARCMDCGTPFCHQENSGCPLGNKIPE
FNELVYQNRWHEALERLLETNNFPEFTGRVCPAPCEGSCVLGIIENPVSIKSIECAIIDK
AFEEGWMVPRPPVKRTGKRVAIVGSGPAGLAAADQLNRIGHTVTVYERADRIGGLMMYGV
PNMKTDKKEIVQRRVNLMAEEGVNFVVNANIGNDPLYSLDRLREENNAIVLAVGATKPRD
LPVPGRELSGVHFAMEFLHANTKSLLDSNLEDGNYISAKGKKVVVIGGGDTGTDCIGTSV
RHGCTNIINLELLPEPPRKRAPGNPWPQWPRVFRVDYGHQEVAAKFGKDPRTYEVLTKRF
VGDENGALKGLEVVRVKWEKDETGRFQFNEIEGSEEILEADLVLLAMGFLGPEATVAEKL
GLERDQRSNYKADYGRFSTNVDGVFAAGDCRRGQSLVVWAISEGRQVAAQVDKYLSKEEE
DHAISNGSHQNVGKRHRDLNPTGTSKHTVMT
Download sequence
Identical sequences MDP0000442206 MDP0000442206|PACid:22660061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]