SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000456223|PACid:22643829 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000456223|PACid:22643829
Domain Number 1 Region: 1-53
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000358
Family GDI-like N domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000456223|PACid:22643829
Sequence length 61
Sequence
MDEEYDVIVLGTGLKECILSGLLSVDGLKVLHMDRNDYYGGECASLNLVQVPFCRLLESL
R
Download sequence
Identical sequences MDP0000456223|PACid:22643829 MDP0000456223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]