SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000464598|PACid:22637924 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  MDP0000464598|PACid:22637924
Domain Number - Region: 30-97
Classification Level Classification E-value
Superfamily Ctag/Cox11 0.0392
Family Ctag/Cox11 0.016
Further Details:      
 
Domain Number - Region: 112-152
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0734
Family FAD/NAD-linked reductases, N-terminal and central domains 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000464598|PACid:22637924
Sequence length 202
Sequence
MAVSIPIVAIVTSLHLIAFIFAVGAERRRSTAKIVPDEYDERTYCVYGTDASTVYGLAAF
GLLAVSQTVLNVVTRCLCCGKGLVTGSSTTWTVFFFVFSWTTFLGAEACLLAGSAKNAYH
TKYRGIFKVDDLSCATLRKGVFAAGAALTLLSLAGSSLYYWAHSKADTGGWEKHRNEGLD
MSSSNYGQHEQXEQQTSGFQKV
Download sequence
Identical sequences MDP0000464598|PACid:22637924 XP_008389255.1.92800 MDP0000464598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]