SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000465595|PACid:22654474 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000465595|PACid:22654474
Domain Number 1 Region: 9-288,419-474
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.94e-47
Family FAD-linked reductases, N-terminal domain 0.00000413
Further Details:      
 
Domain Number 2 Region: 316-420
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.85e-19
Family GMC oxidoreductases 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000465595|PACid:22654474
Sequence length 477
Sequence
MTSDVNEVSGKSFDYIVIGGGTAGCPLAATLSEKFSVLLVERGGSPYGNPLVLDTKYYGF
SLLQTDQYTSVAQSFVSNDGVSNLRGRVLGGASAINGGFYSRASEDFVEKVAWDKETVTN
AYQWVESRVVFKPELTPWQYAAEFSFLEAGVFPYNGFSLDHIKGTKVGASVFDEQGRRQT
SADLLEAGNPNNITVLLNATVKNVIFHRKGDRNETIAGGIRFIKSNGNSSETYEAHLNQT
ENSCSRGDVILAAAALGSPQILLSSAIGPHQHLKNFNIELVVDLDVLCLAHILMKPPKVV
GIADDFKIIIEAGISPVSSNATVMPIAAKLAFPVSEGTLELISTDPRENPSVTFNYLANE
KDLAECVKLSQLLERVVRSESVAFFLGIECKRKDELMSTEDELRKLCKKNVRTFYHYHGG
CTMGSVVDKDYRVYGVKGLRVVDGSTFFESPGTNPMATLLMLGRYLGMNILQERENA
Download sequence
Identical sequences MDP0000465595|PACid:22654474 MDP0000465595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]