SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000485280|PACid:22659457 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000485280|PACid:22659457
Domain Number 1 Region: 171-266
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.68e-28
Family B3 DNA binding domain 0.00014
Further Details:      
 
Domain Number 2 Region: 47-104
Classification Level Classification E-value
Superfamily DNA-binding domain 0.000000000000131
Family GCC-box binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000485280|PACid:22659457
Sequence length 353
Sequence
MAEDASIMISSAQRNVGLETSDSNETDFALLHQNKRARHDNDXSFAKFKGVVPQQNGHWG
AQIYANHQRIWLGTFKSEKEAAMAYDSAAVKLRNGKDLHRNFPWTNFTIQEPDFQNHYTT
EAIIKMIRDGSYPSKFDAFMRSQAQSQIEEMSKGTNPIRVHGDGQVLCRQLFQKELTPSD
VGKLNRLVIPKKYAVEYFPCICENXEENVTEDIELVFYDKLMRVWKFRYCYWRSSQSFVF
TRGWNRFVKENNLKANDVITFYACESDGQVIREEDRESTTFWLIDVMHSEGESKRSCFVE
EASECKDLQVKLELNLGECSSSKFQKGEGKYSEDHRXSIAEEKGIRLFGVNIN
Download sequence
Identical sequences MDP0000485280|PACid:22659457 XP_008338512.1.92800 MDP0000485280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]