SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000525742|PACid:22647174 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000525742|PACid:22647174
Domain Number 1 Region: 76-178
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.07e-22
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000525742|PACid:22647174
Sequence length 207
Sequence
MAAGVKIGTGFPPVPTHRVTTXMSSLXPPPPHHTLFYLRASLPSRRRPPSLCLXSRSRPL
RASSESPPASPENAIENVVIIGSGPAGFTAAIYAARANLKPLVFEGYQSGPGGQLMTTTE
VENFPGFPEGITGPDLMERMRKQAERWGAELYQEDVESIDVKTRPFTVESSERKLQMCTS
VTGIGWTMHRFIDQWLMDQLPYFQPVR
Download sequence
Identical sequences MDP0000525742|PACid:22647174 MDP0000525742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]