SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000526584|PACid:22649377 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000526584|PACid:22649377
Domain Number 1 Region: 208-303
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.73e-25
Family B3 DNA binding domain 0.00026
Further Details:      
 
Domain Number 2 Region: 83-139
Classification Level Classification E-value
Superfamily DNA-binding domain 0.00000000000000719
Family GCC-box binding domain 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000526584|PACid:22649377
Sequence length 437
Sequence
MREQSVQSITHVCYTIKKLDGLEERDPEMIPFTGSLSKRSVMEEGMSRTISNVGVKRDVE
EVCDPNLAANDSSDGASRHVSKRFKGVVEQPNGHWGAQIYANHERVWLGTFSSENEAAMA
YDSAAIKLRGWECHRNFPWTKVTFEEPHFQNQYSKEAVLRMIKDXSYQAEFLEYRKSCAA
SKSLRSGIQFDSLVRVHSNGNAKMLNRLLFQKELTPSDVSKLNRLVIPVTNAKRCFPSIS
ESISQKVESGSSQLVFYDKMMRSWTFRYCYWKSSRSFVFTRGWSRFVKTHHLKAKDILTF
FQCHYKQLGDNGNXEPQTFYMVKVNWDGAESEDDNINCLVENDANNYQYDKCKLXSVSQN
INEAEGIXADQKKRFRLFGVEICNEEDNVGLGQEEEHGLGLYEAQLLEWKDELATVDPAI
TSMRFDRLTSRYTIEDD
Download sequence
Identical sequences MDP0000526584|PACid:22649377 MDP0000526584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]