SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000538071|PACid:22663035 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000538071|PACid:22663035
Domain Number 1 Region: 9-122
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 4.05e-29
Family GMC oxidoreductases 0.00063
Further Details:      
 
Domain Number 2 Region: 121-176
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000142
Family FAD-linked reductases, N-terminal domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000538071|PACid:22663035
Sequence length 183
Sequence
MDSLEDAAFXGGFILEKVMGPISTGHMELRTRNPNDNPAVTFNYFKEPQDLERCVQGIET
IEKIXESKAFSKFRYEGMSIAALLNATASSPVNLLPKHANASRSLDQFCKDTVMTIWHYH
GGCQVGRVVDHDYKVLGVDALRVIDGSTFNYSPGTNPQATVMMLGRYMGKTILDERLASD
VSN
Download sequence
Identical sequences MDP0000538071 MDP0000538071|PACid:22663035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]