SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000549056|PACid:22637942 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000549056|PACid:22637942
Domain Number 1 Region: 272-375
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.1e-22
Family B3 DNA binding domain 0.0000307
Further Details:      
 
Domain Number 2 Region: 156-198
Classification Level Classification E-value
Superfamily DNA-binding domain 0.00000000268
Family GCC-box binding domain 0.0023
Further Details:      
 
Weak hits

Sequence:  MDP0000549056|PACid:22637942
Domain Number - Region: 54-80
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0136
Family Retrovirus zinc finger-like domains 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000549056|PACid:22637942
Sequence length 404
Sequence
MWKLNGVPYKAVVMLKEFKLKXPWRIAGEXSVGFEVEENHRCRITMLDSNPNDCADSSTQ
VPDLSCRPCGKEGHANPTCTYQYYVPKGEQVGRGATLICTCCKKEGCHPGTNDWVGIAVP
NYCKICGKRYEHRTEDCPRKQGMEMVGDQAAFVGGAQIYEESHRVWLGTFDDEEEAAKTY
NIASLKFRGLDAVTNFSRNQMTPYERDVTQALFLESHSMAEIVDMLRKHSYANELEMYKH
KLYNGGALGLDAGGKSIKCHLDLMDTCSSERELLFEKVATPSDVGRLNCMVITKQHAEKH
VQVQLSVGFGRGVLLKFEDEVGKGWRFGYCYWRSSQSYVLSKGWIRFVKEKKLKAGDVVR
LERSVGEDKKLFIDCRPRNVDVSRIREMHGWVGQSHHSIILNRP
Download sequence
Identical sequences MDP0000549056 MDP0000549056|PACid:22637942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]