SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000550049|PACid:22646916 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000550049|PACid:22646916
Domain Number 1 Region: 117-217
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.19e-38
Family B3 DNA binding domain 0.0067
Further Details:      
 
Domain Number 2 Region: 592-663
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000327
Family PB1 domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000550049|PACid:22646916
Sequence length 663
Sequence
MKLSASGLGQQDHEGGGGGGVEKKCLNSELWHACAGPLVSLPTRGTRVVYFPQGHSDQVA
ATTNKQIDAHLPNYPSLPPQLICQLHNITMHADVETDEVYAQMTLQPLTPQEQKETFLPM
ELGLPSKQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFTLQPPAQELIARDLHD
VEWKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVGWDESTAGERQPRVSLWEIEPLT
TFPMYPSLFPLRLKRPWHPGASSMHDNRDESNSLMWLRGGAVEQGLQSMNFQNVGMFPWM
QQRLDSTLIGNDHNQQYQAMLAAGSQNLGSGDQLRQQMMHFQQPFQYVQQSGSHNPMLQL
QQQAIQQSIPHNILQGQQQVSMENMPQHLLQQQFNNQTDEQAQQHQNAYQDALKVQNEQL
HQSQQMNVSSTSFLKTDLSDSSTKFSASTTPRQNMLGTLCPDGSGNLLSMSRAGHSMPTE
QSPQQSWAPKYAXGQANAFANSMSFPPFNEKDNAVEQENLNSDTHNPTLFGVNIESSGLL
FPTSAPSFATSSNDADISMPLGDSGLQRSLYGCMQDSSELLHSAGQVDPPTPNNCTFVKV
YKSGSVGRSLDISRFSSYHELREELGQMFGIEGKLEDRLRSGWQLVFVDREDDVLLLGDD
PWE
Download sequence
Identical sequences MDP0000550049 MDP0000550049|PACid:22646916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]