SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for MDP0000566907|PACid:22652228 from Malus domestica v196

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000566907|PACid:22652228
Domain Number 1 Region: 184-285
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000863
Family B3 DNA binding domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000566907|PACid:22652228
Sequence length 392
Sequence
MARLLSEKYFNGLTEWPQNFTRLDWLVRIAEVEVEIMQQKRETLMREGALKKPMLVEPPK
KQRSPPIDSTRTDHSLKRKWSSNRINDDRAPKKQRSCDGPKLKASAMESSRRETNAIGRG
DVGWKKRKVMPKNNVKKAKGSTKNSPKKKEPIGSPSTPPKYHDLPDEFKREIARLEGTRL
GLVIQKRITMTDISPGENRLSMPEAQIVSMDFLEAKEKELLEGQQTMKVQLIDPGLVKGD
INLRLWHMKSSKLYVLRTQWGAVAQRNKLKPGQLVQVWSFRVNGALHLALVLVKESGGKG
DRKESDGSDSGGRRIAVEGETSGGSGGGTEIMEEKKDENNGNASAASTVINGSDHESPNP
GGDYACPNPGGGHASPNPSGSSKEDADVERKL
Download sequence
Identical sequences MDP0000566907 MDP0000566907|PACid:22652228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]